PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G00050.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 1706aa    MW: 185144 Da    PI: 7.429
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G00050.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY971.2e-3015731629360
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY    3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60  
                       Dgy+WrKYGqK+vkgsefprsYY+Ct+++Cpvk+kve +  d+++ ei+Y+geHnh+k
  OGLUM12G00050.2 1573 DGYSWRKYGQKQVKGSEFPRSYYKCTHPTCPVKRKVEMTP-DGRIAEIVYNGEHNHPK 1629
                       9***************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5022211.835213248IPR002048EF-hand domain
SuperFamilySSF474732.11E-17218348IPR011992EF-hand domain pair
Gene3DG3DSA:1.10.238.101.5E-14219347IPR011992EF-hand domain pair
PROSITE patternPS000180226238IPR018247EF-Hand 1, calcium-binding site
PROSITE profilePS502226.201315350IPR002048EF-hand domain
PROSITE profilePS5092017.3378458IPR018108Mitochondrial substrate/solute carrier
SuperFamilySSF1035064.45E-57379638IPR023395Mitochondrial carrier domain
PfamPF001531.2E-11379459IPR018108Mitochondrial substrate/solute carrier
Gene3DG3DSA:1.50.40.108.6E-58379643IPR023395Mitochondrial carrier domain
PRINTSPR009269.2E-5383396IPR002067Mitochondrial carrier protein
PRINTSPR009269.2E-5396410IPR002067Mitochondrial carrier protein
PROSITE profilePS5092014.79467549IPR018108Mitochondrial substrate/solute carrier
PfamPF001531.5E-6472549IPR018108Mitochondrial substrate/solute carrier
PfamPF001535.0E-20557645IPR018108Mitochondrial substrate/solute carrier
PROSITE profilePS5092019.703558643IPR018108Mitochondrial substrate/solute carrier
PRINTSPR009269.2E-5567589IPR002067Mitochondrial carrier protein
PROSITE profilePS5081123.7215661630IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.9E-2715661630IPR003657WRKY domain
SuperFamilySSF1182908.37E-2415681630IPR003657WRKY domain
SMARTSM007741.7E-3415711629IPR003657WRKY domain
PfamPF031061.0E-2315731628IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055085Biological Processtransmembrane transport
GO:0009941Cellular Componentchloroplast envelope
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005509Molecular Functioncalcium ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1706 aa     Download sequence    Send to blast
MSRSEHPMVA AARAALAHLQ LPLPPAPAGS NMDHHLLPHF LHRSPPSPCF LLLRTQHKPK  60
PPQPQLHLLL CTAFDSLAHS LQEVLDKHKP KLHLDTLFLH GNLPFAKVGV PPPPPPPAPL  120
LSPPSVSAHH QHQPATPTET ETEDTAANDS PPPRTLPVRL LNIPVDRLRS TLSTLSLTEL  180
IDLVPHLVAR SLPSPDTHPD KKKLFSVHHF FRYAEFEGKR FFEELDRDGD GQVTLEDLEV  240
AMRKRRLPRR YARDFLRRTR SNLFSKSIGW KQFLSLMEQK EPTILRAYTT LCLSKSGTLH  300
KNQILTSLKG AGLPANEDNA AAMLRYLNAD SEESISYSHF RNFMLLLPSE RLEDDPRNIW  360
FEAATLVAVP PPVEISTGSV LKSALAGGLA SALSTSVMHP IDSMKTRVQA SSLSFPDLIS  420
TLPQIGLRGL YRGSIPAILG QFSSHGLRTG IFEASKLVLK SVAPTLSDIQ VQSLSSFCST  480
ILGTAVRIPC EVLKQRLQAG IFNNVGEAIV GTMQKDGPKG FFRGTGATLC REVPFYVAGM  540
CLYAEAKKAA QHVLNRDLEP WETIAVGALS GGLAAVVTTP FDVMKTRMMT APPGTPVSMQ  600
LIVFSILRNE GPLGLFKGAI PRFFWIAPLG AMNFAGYELA KKAMIQTESD SADCNKENNI  660
SQNRRHVLDC QTPCEGKGAA TSKKRKNKPA GGFNLRKSIA WNPAFFTEQG VLDNTELSML  720
TGSQVKATRS PASGFSSTFS PLSRFGKSSN TSVLKEIGEN SRGKFPSKCL SAENKGRKLF  780
ASSKASEQDE RKALAGTQDK RSAKAIQKIP KKSEPSPSVV SRSRSTSSVT NVPKPTTRPA  840
TVTSECTHKV EGLPLKSKTE RSSVTKSSGP TIGKDMVPPT VTTICQETNG SGKCETFSPY  900
SQDNPSSSVV APARISAKPS ALRMPSPSVG FFTQGKASVS HSGTAQRNPE RCFSGNISSV  960
KPPSLPVQSA TSDSTPNVLA SSLPGVEDAT VCSLKQSLSE STVPYSEKSG NISYQEMPDD  1020
DFSLAGNGAT TELSFRDNDD GRNSMPNECS VALSVGQDLN AICCSSTEPA EDSCFLKVIC  1080
SSSEPSVGSN LTTSCISSPG CTPNDLNSQS KSDNGETAVD IENSLSGETS GTVCSSEGNN  1140
CTSATDSLRK SDSCHQQNML VQSIHCTDQM PQFDSSTGIK PSLAYSQLDS NNSLCSEVQL  1200
TSSEGPDIDS EMELDTDDSF TVEEPPLLHV GDECDHDYRS AECSHMNLAA PSPCVDQEAL  1260
AGNLTEKVDT ADGRTESHHC STQERRPILS EEQDTEDKIE FDTKLSSSEG ASSIERIKSV  1320
GKSRTNTISK DHLKNLVPFT EEWLAVMEAF GEEVLEQKTG AVQNSPTDKA APEPSPWSPV  1380
KRKAQDVGPF DCTKYSKNVR TKQQQQPTVL AIDSFCAALE SLIVSVLAPF NSTSFSPFDC  1440
IYQSLPVTAQ DFGTWCDMQS HKKVAAVKPV ASRPSSRLRS FSMLQEDSTA IDSPRVTSLE  1500
EIILRRTKAT RFTHPLSNSS TEIAATRLED SGTHTTCDQK KADTGKGACW DNLTVSQSVR  1560
KPNVSAKNSL SYDGYSWRKY GQKQVKGSEF PRSYYKCTHP TCPVKRKVEM TPDGRIAEIV  1620
YNGEHNHPKP HPPRKPTLST SVETLVATND AGLENKLEGC DQAIGSDAVV EALRGGCHCL  1680
DGFRNGNEIS DCKKRYAYAV IFIQEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lck_A1e-173856456287Mitochondrial uncoupling protein 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0686220.0AK068622.1 Oryza sativa Japonica Group cDNA clone:J013154A11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0BMK00.0A0A0E0BMK0_9ORYZ; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.17e-27WRKY family protein